SCOPe 2.08: Domain d4kafb1: 4kaf B:-1-303

Lineage for d4kafb1 (4kaf B:-1-303)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.8: Haloalkane dehalogenase [53513] (2 proteins)

6. Protein automated matches [190880] (5 species)
   not a true protein

7. Species Rhodococcus sp. [TaxId:1831] [189207] (19 PDB entries)

8. Domain d4kafb1: 4kaf B:-1-303 [202842]
   Other proteins in same PDB: d4kafa2, d4kafa3, d4kafb2
   automated match to d4kafa_
   complexed with edo, na, peg, scn

Details for d4kafb1

PDB Entry: 4kaf, 1.5 Å

PDB Description: Crystal Structure of Haloalkane dehalogenase HaloTag7 at the resolution 1.5A, Northeast Structural Genomics Consortium (NESG) Target OR151

PDB Compounds: (B:) haloalkane dehalogenase

SCOPe Domain Sequences for d4kafb1:

Sequence; same for both SEQRES and ATOM records:

>d4kafb1 c.69.1.8 (B:-1-303) automated matches {Rhodococcus sp. [TaxId: 1831]}
shmaeigtgfpfdphyvevlgermhyvdvgprdgtpvlflhgnptssyvwrniiphvapt
hrciapdligmgksdkpdlgyffddhvrfmdafiealgleevvlvihdwgsalgfhwakr
nperikgiafmefirpiptwdewpefaretfqafrttdvgrkliidqnvfiegtlpmgvv
rpltevemdhyrepflnpvdreplwrfpnelpiagepanivalveeymdwlhqspvpkll
fwgtpgvlippaeaarlakslpnckavdigpglnllqednpdligseiarwlstl

Timeline for d4kafb1:

• d4kafb1 first appeared in SCOPe 2.03, called d4kafb_
  
• d4kafb1 appears in SCOPe 2.07