Lineage for d4k4ym1 (4k4y M:1-462)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3016464Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 3016465Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 3017418Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins)
  6. 3017732Protein automated matches [190260] (25 species)
    not a true protein
  7. 3017956Species Human coxsackievirus B3 [TaxId:12072] [193138] (3 PDB entries)
  8. 3017968Domain d4k4ym1: 4k4y M:1-462 [202831]
    Other proteins in same PDB: d4k4ya2, d4k4ye2, d4k4yi2, d4k4ym2
    automated match to d4k4xa_
    protein/RNA complex; complexed with act, dct, gol

Details for d4k4ym1

PDB Entry: 4k4y (more details), 2.72 Å

PDB Description: coxsackievirus b3 polymerase elongation complex (r2+1_form)
PDB Compounds: (M:) RNA-dependent RNA polymerase

SCOPe Domain Sequences for d4k4ym1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k4ym1 e.8.1.4 (M:1-462) automated matches {Human coxsackievirus B3 [TaxId: 12072]}
geiefiesskdagfpvintpsktklepsvfhqvfegnkepavlrsgdprlkanfeeaifs
kyignvnthvdeymleavdhyagqlatldistepmkledavygteglealdlttsagypy
valgikkrdilskktkdltklkecmdkyglnlpmvtyvkdelrsiekvakgksrlieass
lndsvamrqtfgnlyktfhlnpgvvtgsavgcdpdlfwskipvmldghliafdysgydas
lspvwfaclkmileklgythketnyidylcnshhlyrdkhyfvrggmpsgcsgtsifnsm
inniiirtlmlkvykgidldqfrmiaygddviasypwpidasllaeagkgyglimtpadk
gecfnevtwtnvtflkryfradeqypflvhpvmpmkdihesirwtkdpkntqdhvrslcl
lawhngeheyeefirkirsvpvgrcltlpafstlrrkwldsf

SCOPe Domain Coordinates for d4k4ym1:

Click to download the PDB-style file with coordinates for d4k4ym1.
(The format of our PDB-style files is described here.)

Timeline for d4k4ym1: