Lineage for d1nfde1 (1nfd E:2-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2741614Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 2741615Species Chinese hamster (Cricetulus griseus) [TaxId:10029] [88542] (1 PDB entry)
  8. 2741616Domain d1nfde1: 1nfd E:2-107 [20186]
    Other proteins in same PDB: d1nfda1, d1nfda2, d1nfdb1, d1nfdb2, d1nfdc1, d1nfdc2, d1nfdd1, d1nfdd2, d1nfde2, d1nfdf1, d1nfdf2, d1nfdg2, d1nfdh1, d1nfdh2
    part of Fab H57
    complexed with nag

Details for d1nfde1

PDB Entry: 1nfd (more details), 2.8 Å

PDB Description: an alpha-beta t cell receptor (tcr) heterodimer in complex with an anti-tcr fab fragment derived from a mitogenic antibody
PDB Compounds: (E:) h57 fab

SCOPe Domain Sequences for d1nfde1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nfde1 b.1.1.1 (E:2-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}
yeliqpssasvtvgetvkitcsgdqlpknfaywfqqksdknillliymdnkrpsgiperf
sgstsgttatltisgaqpedeaayyclssygdnndlvfgsgtqltvlr

SCOPe Domain Coordinates for d1nfde1:

Click to download the PDB-style file with coordinates for d1nfde1.
(The format of our PDB-style files is described here.)

Timeline for d1nfde1: