SCOPe 2.04: Domain d3u0pc2: 3u0p C:184-279

Lineage for d3u0pc2 (3u0p C:184-279)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein CD1, alpha-3 domain [88615] (5 species)

7. Species Human (Homo sapiens), CD1a [TaxId:9606] [101513] (5 PDB entries)

8. Domain d3u0pc2: 3u0p C:184-279 [200913]
   Other proteins in same PDB: d3u0pa1, d3u0pb_, d3u0pc1, d3u0pd_, d3u0pe1, d3u0pf_
   automated match to d1onqa1
   complexed with gol, hex, lsc, nbu, so4, und

Details for d3u0pc2

PDB Entry: 3u0p, 2.8 Å

PDB Description: crystal structure of human cd1d-lysophosphatidylcholine

PDB Compounds: (C:) Antigen-presenting glycoprotein CD1d

SCOPe Domain Sequences for d3u0pc2:

Sequence; same for both SEQRES and ATOM records:

>d3u0pc2 b.1.1.2 (C:184-279) CD1, alpha-3 domain {Human (Homo sapiens), CD1a [TaxId: 9606]}
qvkpkawlsrgpspgpgrlllvchvsgfypkpvwvkwmrgeqeqqgtqpgdilpnadetw
ylratldvvageaaglscrvkhsslegqdivlywhh

Timeline for d3u0pc2:

• d3u0pc2 first appeared in SCOPe 2.03
  
• d3u0pc2 appears in SCOPe 2.05
  
• d3u0pc2 appears in the current release, SCOPe 2.08