| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species) VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species |
| Species Mouse (Mus musculus), cluster 1 [TaxId:10090] [88548] (68 PDB entries) Uniprot P01796 # ! HV27_MOUSE Ig heavy chain V-III region A4 |
| Domain d1iaii1: 1iai I:1-121 [20075] Other proteins in same PDB: d1iaih2, d1iaii2, d1iail1, d1iail2, d1iaim1, d1iaim2 part of Fab 409.5.3 |
PDB Entry: 1iai (more details), 2.9 Å
SCOPe Domain Sequences for d1iaii1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iaii1 b.1.1.1 (I:1-121) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]}
evklqesggglvqpggsmklscvasgftfnnywmswvrqspekglewvaeirlnsdnfat
hyaesvkgkfiisrddsksrlylqmnslraedtgiyycvlrplfyyavdywgqgtsvtvs
s
Timeline for d1iaii1: