Lineage for d3gsnh2 (3gsn H:182-274)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1762660Protein automated matches [190374] (14 species)
    not a true protein
  7. 1762816Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries)
  8. 1763495Domain d3gsnh2: 3gsn H:182-274 [199452]
    Other proteins in same PDB: d3gsna1, d3gsnb1, d3gsnh1, d3gsnl_
    automated match to d1x7qa1
    complexed with cl, so4

Details for d3gsnh2

PDB Entry: 3gsn (more details), 2.8 Å

PDB Description: crystal structure of the public ra14 tcr in complex with the hcmv dominant nlv/hla-a2 epitope
PDB Compounds: (H:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d3gsnh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gsnh2 b.1.1.2 (H:182-274) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwvavvvpsgqeqrytchvqheglpkpltlrw

SCOPe Domain Coordinates for d3gsnh2:

Click to download the PDB-style file with coordinates for d3gsnh2.
(The format of our PDB-style files is described here.)

Timeline for d3gsnh2: