SCOPe 2.05: Domain d3gsnh1: 3gsn H:1-181

Lineage for d3gsnh1 (3gsn H:1-181)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein automated matches [191280] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189896] (24 PDB entries)

8. Domain d3gsnh1: 3gsn H:1-181 [199451]
   Other proteins in same PDB: d3gsna1, d3gsna2, d3gsnb1, d3gsnb2, d3gsnh2, d3gsnl_
   automated match to d1x7qa2
   complexed with cl, so4

Details for d3gsnh1

PDB Entry: 3gsn, 2.8 Å

PDB Description: crystal structure of the public ra14 tcr in complex with the hcmv dominant nlv/hla-a2 epitope

PDB Compounds: (H:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d3gsnh1:

Sequence; same for both SEQRES and ATOM records:

>d3gsnh1 d.19.1.1 (H:1-181) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

Timeline for d3gsnh1:

• d3gsnh1 first appeared in SCOPe 2.03
  
• d3gsnh1 appears in SCOPe 2.04
  
• d3gsnh1 appears in SCOPe 2.06
  
• d3gsnh1 appears in the current release, SCOPe 2.08