![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein automated matches [191280] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189896] (24 PDB entries) |
![]() | Domain d3gsnh1: 3gsn H:1-181 [199451] Other proteins in same PDB: d3gsna1, d3gsna2, d3gsnb1, d3gsnb2, d3gsnh2, d3gsnl_ automated match to d1x7qa2 complexed with cl, so4 |
PDB Entry: 3gsn (more details), 2.8 Å
SCOPe Domain Sequences for d3gsnh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gsnh1 d.19.1.1 (H:1-181) automated matches {Human (Homo sapiens) [TaxId: 9606]} gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq r
Timeline for d3gsnh1: