SCOPe 2.05: Domain d3gsnb1: 3gsn B:2-116

Lineage for d3gsnb1 (3gsn B:2-116)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (18 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (120 PDB entries)

8. Domain d3gsnb1: 3gsn B:2-116 [199449]
   Other proteins in same PDB: d3gsna1, d3gsna2, d3gsnb2, d3gsnh1, d3gsnh2, d3gsnl_
   automated match to d1qrne1
   complexed with cl, so4

Details for d3gsnb1

PDB Entry: 3gsn, 2.8 Å

PDB Description: crystal structure of the public ra14 tcr in complex with the hcmv dominant nlv/hla-a2 epitope

PDB Compounds: (B:) RA14 TCR beta chain (TRBV6-5, TRBD1, TRBJ1-2)

SCOPe Domain Sequences for d3gsnb1:

Sequence; same for both SEQRES and ATOM records:

>d3gsnb1 b.1.1.1 (B:2-116) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mgvtqtpkfqvlktgqsmtlqcaqdmnheymswyrqdpgmglrlihysvgagitdqgevp
ngynvsrsttedfplrllsaapsqtsvyfcasspvtggiygytfgsgtrltvved

Timeline for d3gsnb1:

• d3gsnb1 first appeared in SCOPe 2.03
  
• d3gsnb1 appears in SCOPe 2.04
  
• d3gsnb1 appears in SCOPe 2.06
  
• d3gsnb1 appears in the current release, SCOPe 2.08