SCOPe 2.08: Domain d2hvka1: 2hvk A:6-118

Lineage for d2hvka1 (2hvk A:6-118)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (181 PDB entries)
   Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor

8. Domain d2hvka1: 2hvk A:6-118 [198032]
   Other proteins in same PDB: d2hvka2, d2hvka3, d2hvkb1, d2hvkb2, d2hvkc_
   automated match to d1r3jb1
   complexed with f09, k, l2c, tba

Details for d2hvka1

PDB Entry: 2hvk, 1.9 Å

PDB Description: crystal structure of the kcsa-fab-tba complex in high k+

PDB Compounds: (A:) antibody fab heavy chain

SCOPe Domain Sequences for d2hvka1:

Sequence; same for both SEQRES and ATOM records:

>d2hvka1 b.1.1.1 (A:6-118) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
qpgaelvkpgasvklsckasgytftsdwihwvkqrpghglewigeiipsygranynekiq
kkatltadkssstafmqlssltsedsavyycarergdgyfavwgagttvtvss

Timeline for d2hvka1:

• d2hvka1 first appeared in SCOPe 2.03
  
• d2hvka1 appears in SCOPe 2.07