SCOP 1.63: Domain d7fabl1: 7fab L:1-103

Lineage for d7fabl1 (7fab L:1-103)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Fab NEW (human), lambda L chain [48753] (1 PDB entry)

8. Domain d7fabl1: 7fab L:1-103 [19776]
   Other proteins in same PDB: d7fabh2, d7fabl2

Details for d7fabl1

PDB Entry: 7fab, 2 Å

PDB Description: crystal structure of human immunoglobulin fragment fab new refined at 2.0 angstroms resolution

SCOP Domain Sequences for d7fabl1:

Sequence; same for both SEQRES and ATOM records:

>d7fabl1 b.1.1.1 (L:1-103) Immunoglobulin (variable domains of L and H chains) {Fab NEW (human), lambda L chain}
asvltqppsvsgapgqrvtisctgsssnigaghnvkwyqqlpgtapkllifhnnarfsvs
ksgtsatlaitglqaedeadyycqsydrslrvfgggtkltvlr

Timeline for d7fabl1:

• d7fabl1 first appeared (with stable ids) in SCOP 1.55
  
• d7fabl1 appears in SCOP 1.61
  
• d7fabl1 appears in SCOP 1.65
  
• d7fabl1 appears in the current release, SCOPe 2.08