Lineage for d7fabl1 (7fab L:1-103)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7818Species Fab NEW (human), lambda L chain [48753] (1 PDB entry)
  8. 7820Domain d7fabl1: 7fab L:1-103 [19776]
    Other proteins in same PDB: d7fabh2, d7fabl2

Details for d7fabl1

PDB Entry: 7fab (more details), 2 Å

PDB Description: crystal structure of human immunoglobulin fragment fab new refined at 2.0 angstroms resolution

SCOP Domain Sequences for d7fabl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7fabl1 b.1.1.1 (L:1-103) Immunoglobulin (variable domains of L and H chains) {Fab NEW (human), lambda L chain}
asvltqppsvsgapgqrvtisctgsssnigaghnvkwyqqlpgtapkllifhnnarfsvs
ksgtsatlaitglqaedeadyycqsydrslrvfgggtkltvlr

SCOP Domain Coordinates for d7fabl1:

Click to download the PDB-style file with coordinates for d7fabl1.
(The format of our PDB-style files is described here.)

Timeline for d7fabl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d7fabl2