Lineage for d7fabh2 (7fab H:117-217)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221641Species Fab NEW (human), lambda L chain [48976] (1 PDB entry)
  8. 221642Domain d7fabh2: 7fab H:117-217 [20887]
    Other proteins in same PDB: d7fabh1, d7fabl1

Details for d7fabh2

PDB Entry: 7fab (more details), 2 Å

PDB Description: crystal structure of human immunoglobulin fragment fab new refined at 2.0 angstroms resolution

SCOP Domain Sequences for d7fabh2:

Sequence, based on SEQRES records: (download)

>d7fabh2 b.1.1.2 (H:117-217) Immunoglobulin (constant domains of L and H chains) {Fab NEW (human), lambda L chain}
sastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqs
sglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Sequence, based on observed residues (ATOM records): (download)

>d7fabh2 b.1.1.2 (H:117-217) Immunoglobulin (constant domains of L and H chains) {Fab NEW (human), lambda L chain}
sastkgpsvfplaptaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslss
vvtvpssslgtqtyicnvnhkpsntkvdkkvep

SCOP Domain Coordinates for d7fabh2:

Click to download the PDB-style file with coordinates for d7fabh2.
(The format of our PDB-style files is described here.)

Timeline for d7fabh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d7fabh1