Lineage for d1hnga1 (1hng A:2-99)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739582Protein CD2, first domain [48740] (2 species)
  7. 2739589Species Norway rat (Rattus norvegicus) [TaxId:10116] [48742] (5 PDB entries)
  8. 2739590Domain d1hnga1: 1hng A:2-99 [19752]
    Other proteins in same PDB: d1hnga2, d1hngb2

Details for d1hnga1

PDB Entry: 1hng (more details), 2.8 Å

PDB Description: crystal structure at 2.8 angstroms resolution of a soluble form of the cell adhesion molecule cd2
PDB Compounds: (A:) cd2

SCOPe Domain Sequences for d1hnga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnga1 b.1.1.1 (A:2-99) CD2, first domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dsgtvwgalghginlnipnfqmtddidevrwergstlvaefkrkmkpflksgafeilang
dlkiknltrddsgtynvtvystngtrilnkaldlrile

SCOPe Domain Coordinates for d1hnga1:

Click to download the PDB-style file with coordinates for d1hnga1.
(The format of our PDB-style files is described here.)

Timeline for d1hnga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hnga2