Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein CD2, first domain [48740] (2 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [48742] (5 PDB entries) |
Domain d1hnga1: 1hng A:2-99 [19752] Other proteins in same PDB: d1hnga2, d1hngb2 |
PDB Entry: 1hng (more details), 2.8 Å
SCOPe Domain Sequences for d1hnga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hnga1 b.1.1.1 (A:2-99) CD2, first domain {Norway rat (Rattus norvegicus) [TaxId: 10116]} dsgtvwgalghginlnipnfqmtddidevrwergstlvaefkrkmkpflksgafeilang dlkiknltrddsgtynvtvystngtrilnkaldlrile
Timeline for d1hnga1: