Lineage for d3h05b_ (3h05 B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2118897Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2118898Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2119569Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2119570Protein automated matches [190459] (50 species)
    not a true protein
  7. 2119947Species Vibrio parahaemolyticus [TaxId:670] [196584] (1 PDB entry)
  8. 2119949Domain d3h05b_: 3h05 B: [196585]
    automated match to d2h29a_
    complexed with cl

Details for d3h05b_

PDB Entry: 3h05 (more details), 1.65 Å

PDB Description: the crystal structure of a putative nicotinate-nucleotide adenylyltransferase from vibrio parahaemolyticus
PDB Compounds: (B:) uncharacterized protein VPA0413

SCOPe Domain Sequences for d3h05b_:

Sequence, based on SEQRES records: (download)

>d3h05b_ c.26.1.0 (B:) automated matches {Vibrio parahaemolyticus [TaxId: 670]}
mkkiaifgsafnppslghksvieslshfdlvllepsiahawgknmldypircklvdafik
dmglsnvqrsdleqalyqpgqsvttyallekiqeiyptaditfvigpdnffkfakfykae
eiterwtvmacpekvkirstdirnaliegkdistyttptvselllneglyretlsgk

Sequence, based on observed residues (ATOM records): (download)

>d3h05b_ c.26.1.0 (B:) automated matches {Vibrio parahaemolyticus [TaxId: 670]}
mkkiaifgsafnppslghksvieslshfdlvllepsinmldypircklvdafikdmglsn
vqrsdleqalyvttyallekiqeiyptaditfvigpdnffkfakfykaeeiterwtvmac
pekvstdirnaliegkdistyttptvselllneglyretlsgk

SCOPe Domain Coordinates for d3h05b_:

Click to download the PDB-style file with coordinates for d3h05b_.
(The format of our PDB-style files is described here.)

Timeline for d3h05b_: