Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.0: automated matches [191377] (1 protein) not a true family |
Protein automated matches [190459] (18 species) not a true protein |
Species Vibrio parahaemolyticus [TaxId:670] [196584] (1 PDB entry) |
Domain d3h05b_: 3h05 B: [196585] automated match to d2h29a_ complexed with cl |
PDB Entry: 3h05 (more details), 1.65 Å
SCOPe Domain Sequences for d3h05b_:
Sequence, based on SEQRES records: (download)
>d3h05b_ c.26.1.0 (B:) automated matches {Vibrio parahaemolyticus [TaxId: 670]} mkkiaifgsafnppslghksvieslshfdlvllepsiahawgknmldypircklvdafik dmglsnvqrsdleqalyqpgqsvttyallekiqeiyptaditfvigpdnffkfakfykae eiterwtvmacpekvkirstdirnaliegkdistyttptvselllneglyretlsgk
>d3h05b_ c.26.1.0 (B:) automated matches {Vibrio parahaemolyticus [TaxId: 670]} mkkiaifgsafnppslghksvieslshfdlvllepsinmldypircklvdafikdmglsn vqrsdleqalyvttyallekiqeiyptaditfvigpdnffkfakfykaeeiterwtvmac pekvstdirnaliegkdistyttptvselllneglyretlsgk
Timeline for d3h05b_: