Lineage for d4dgda_ (4dgd A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2806645Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 2806646Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 2806647Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 2806997Protein automated matches [190077] (22 species)
    not a true protein
  7. 2807069Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [189056] (4 PDB entries)
  8. 2807070Domain d4dgda_: 4dgd A: [196073]
    automated match to d2wlwa_
    complexed with gol; mutant

Details for d4dgda_

PDB Entry: 4dgd (more details), 1.4 Å

PDB Description: TRIMCyp cyclophilin domain from Macaca mulatta: H70C mutant
PDB Compounds: (A:) trimcyp

SCOPe Domain Sequences for d4dgda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dgda_ b.62.1.1 (A:) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
mcqggnfthcngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

SCOPe Domain Coordinates for d4dgda_:

Click to download the PDB-style file with coordinates for d4dgda_.
(The format of our PDB-style files is described here.)

Timeline for d4dgda_: