Class b: All beta proteins [48724] (180 folds) |
Fold b.62: Cyclophilin-like [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
Superfamily b.62.1: Cyclophilin-like [50891] (5 families) |
Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins) automatically mapped to Pfam PF00160 |
Protein automated matches [190077] (22 species) not a true protein |
Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [189056] (4 PDB entries) |
Domain d2wlwa_: 2wlw A: [169440] automated match to d1ak4a_ |
PDB Entry: 2wlw (more details), 1.5 Å
SCOPe Domain Sequences for d2wlwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wlwa_ b.62.1.1 (A:) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]} vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm cqggnfthhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
Timeline for d2wlwa_: