Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (90 species) not a true protein |
Species Fungus (Fusarium oxysporum) [TaxId:5507] [194927] (1 PDB entry) |
Domain d3u7ba_: 3u7b A: [194930] automated match to d1v6ya_ complexed with edo |
PDB Entry: 3u7b (more details), 1.94 Å
SCOPe Domain Sequences for d3u7ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3u7ba_ c.1.8.0 (A:) automated matches {Fungus (Fusarium oxysporum) [TaxId: 5507]} aasgleaamkaagkqyfgtaltvrndqgeidiinnkneigsitpenamkweaiqpnrgqf nwgpadqhaaaatsrgyelrchtlvwhsqlpswvangnwnnqtlqavmrdhinavmgryr gkcthwdvvnealnedgtyrdsvflrvigeayipiafrmalaadpttklyyndynleygn aktegakriarlvksyglridgiglqahmtsestptqntptpsraklasvlqgladlgvd vayteldirmntpatqqklqtnadayarivgscmdvkrcvgitvwgisdkyswvpgtfpg egsallwndnfqkkpsytstlntinrr
Timeline for d3u7ba_:
View in 3D Domains from other chains: (mouse over for more information) d3u7bb_, d3u7bc_, d3u7bd_, d3u7be_ |