PDB entry 3u7b

View 3u7b on RCSB PDB site
Description: A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft
Class: hydrolase
Keywords: tim barrel, xylanase, hydrolase
Deposited on 2011-10-13, released 2012-07-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-07-18, with a file datestamp of 2012-07-13.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.214
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-1,4-beta-xylanase
    Species: Fusarium oxysporum [TaxId:5507]
    Database cross-references and differences (RAF-indexed):
    • PDB 3U7B (0-326)
    Domains in SCOPe 2.06: d3u7ba_
  • Chain 'B':
    Compound: endo-1,4-beta-xylanase
    Species: Fusarium oxysporum [TaxId:5507]
    Database cross-references and differences (RAF-indexed):
    • PDB 3U7B (0-End)
    Domains in SCOPe 2.06: d3u7bb_
  • Chain 'C':
    Compound: endo-1,4-beta-xylanase
    Species: Fusarium oxysporum [TaxId:5507]
    Database cross-references and differences (RAF-indexed):
    • PDB 3U7B (0-End)
    Domains in SCOPe 2.06: d3u7bc_
  • Chain 'D':
    Compound: endo-1,4-beta-xylanase
    Species: Fusarium oxysporum [TaxId:5507]
    Database cross-references and differences (RAF-indexed):
    • PDB 3U7B (0-326)
    Domains in SCOPe 2.06: d3u7bd_
  • Chain 'E':
    Compound: endo-1,4-beta-xylanase
    Species: Fusarium oxysporum [TaxId:5507]
    Database cross-references and differences (RAF-indexed):
    • PDB 3U7B (0-End)
    Domains in SCOPe 2.06: d3u7be_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3u7bA (A:)
    aasgleaamkaagkqyfgtaltvrndqgeidiinnkneigsitpenamkweaiqpnrgqf
    nwgpadqhaaaatsrgyelrchtlvwhsqlpswvangnwnnqtlqavmrdhinavmgryr
    gkcthwdvvnealnedgtyrdsvflrvigeayipiafrmalaadpttklyyndynleygn
    aktegakriarlvksyglridgiglqahmtsestptqntptpsraklasvlqgladlgvd
    vayteldirmntpatqqklqtnadayarivgscmdvkrcvgitvwgisdkyswvpgtfpg
    egsallwndnfqkkpsytstlntinrr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3u7bB (B:)
    aasgleaamkaagkqyfgtaltvrndqgeidiinnkneigsitpenamkweaiqpnrgqf
    nwgpadqhaaaatsrgyelrchtlvwhsqlpswvangnwnnqtlqavmrdhinavmgryr
    gkcthwdvvnealnedgtyrdsvflrvigeayipiafrmalaadpttklyyndynleygn
    aktegakriarlvksyglridgiglqahmtsestptqntptpsraklasvlqgladlgvd
    vayteldirmntpatqqklqtnadayarivgscmdvkrcvgitvwgisdkyswvpgtfpg
    egsallwndnfqkkpsytstlntinrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u7bB (B:)
    aasgleaamkaagkqyfgtaltvrndqgeidiinnkneigsitpenamkweaiqpnrgqf
    nwgpadqhaaaatsrgyelrchtlvwhsqlpswvangnwnnqtlqavmrdhinavmgryr
    gkcthwdvvnealnedgtyrdsvflrvigeayipiafrmalaadpttklyyndynleygn
    aktegakriarlvksyglridgiglqahmtsestptqntptpsraklasvlqgladlgvd
    vayteldirmntpatqqklqtnadayarivgscmdvkrcvgitvwgisdkyswvpgtfpg
    egsallwndnfqkkpsytstlntinr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3u7bC (C:)
    aasgleaamkaagkqyfgtaltvrndqgeidiinnkneigsitpenamkweaiqpnrgqf
    nwgpadqhaaaatsrgyelrchtlvwhsqlpswvangnwnnqtlqavmrdhinavmgryr
    gkcthwdvvnealnedgtyrdsvflrvigeayipiafrmalaadpttklyyndynleygn
    aktegakriarlvksyglridgiglqahmtsestptqntptpsraklasvlqgladlgvd
    vayteldirmntpatqqklqtnadayarivgscmdvkrcvgitvwgisdkyswvpgtfpg
    egsallwndnfqkkpsytstlntinrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u7bC (C:)
    aasgleaamkaagkqyfgtaltvrndqgeidiinnkneigsitpenamkweaiqpnrgqf
    nwgpadqhaaaatsrgyelrchtlvwhsqlpswvangnwnnqtlqavmrdhinavmgryr
    gkcthwdvvnealnedgtyrdsvflrvigeayipiafrmalaadpttklyyndynleygn
    aktegakriarlvksyglridgiglqahmtsestptqntptpsraklasvlqgladlgvd
    vayteldirmntpatqqklqtnadayarivgscmdvkrcvgitvwgisdkyswvpgtfpg
    egsallwndnfqkkpsytstlntinr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3u7bD (D:)
    aasgleaamkaagkqyfgtaltvrndqgeidiinnkneigsitpenamkweaiqpnrgqf
    nwgpadqhaaaatsrgyelrchtlvwhsqlpswvangnwnnqtlqavmrdhinavmgryr
    gkcthwdvvnealnedgtyrdsvflrvigeayipiafrmalaadpttklyyndynleygn
    aktegakriarlvksyglridgiglqahmtsestptqntptpsraklasvlqgladlgvd
    vayteldirmntpatqqklqtnadayarivgscmdvkrcvgitvwgisdkyswvpgtfpg
    egsallwndnfqkkpsytstlntinrr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3u7bE (E:)
    aasgleaamkaagkqyfgtaltvrndqgeidiinnkneigsitpenamkweaiqpnrgqf
    nwgpadqhaaaatsrgyelrchtlvwhsqlpswvangnwnnqtlqavmrdhinavmgryr
    gkcthwdvvnealnedgtyrdsvflrvigeayipiafrmalaadpttklyyndynleygn
    aktegakriarlvksyglridgiglqahmtsestptqntptpsraklasvlqgladlgvd
    vayteldirmntpatqqklqtnadayarivgscmdvkrcvgitvwgisdkyswvpgtfpg
    egsallwndnfqkkpsytstlntinrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u7bE (E:)
    aasgleaamkaagkqyfgtaltvrndqgeidiinnkneigsitpenamkweaiqpnrgqf
    nwgpadqhaaaatsrgyelrchtlvwhsqlpswvangnwnnqtlqavmrdhinavmgryr
    gkcthwdvvnealnedgtyrdsvflrvigeayipiafrmalaadpttklyyndynleygn
    aktegakriarlvksyglridgiglqahmtsestptqntptpsraklasvlqgladlgvd
    vayteldirmntpatqqklqtnadayarivgscmdvkrcvgitvwgisdkyswvpgtfpg
    egsallwndnfqkkpsytstlntinr