SCOPe 2.08: Domain d4hjka1: 4hjk A:1-76

Lineage for d4hjka1 (4hjk A:1-76)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein automated matches [190118] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189560] (113 PDB entries)

8. Domain d4hjka1: 4hjk A:1-76 [194297]
   Other proteins in same PDB: d4hjka2
   automated match to d3nheb_
   complexed with po4

Details for d4hjka1

PDB Entry: 4hjk, 1.78 Å

PDB Description: U7Ub7 Disulfide variant

PDB Compounds: (A:) Ubiquitin

SCOPe Domain Sequences for d4hjka1:

Sequence; same for both SEQRES and ATOM records:

>d4hjka1 d.15.1.1 (A:1-76) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqifvkcltgktntlevepsdtienvkakiqdkigyppdqqrlifagkqledgrtlsdyn
iqkestlhcvrrlrgg

Timeline for d4hjka1:

• d4hjka1 first appeared in SCOPe 2.02, called d4hjka_
  
• d4hjka1 appears in SCOPe 2.07