Lineage for d4h53c_ (4h53 C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2807606Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2807607Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2807608Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. 2807958Protein automated matches [193245] (21 species)
    not a true protein
  7. 2808018Species Influenza A virus [TaxId:382827] [193246] (9 PDB entries)
  8. 2808021Domain d4h53c_: 4h53 C: [193983]
    automated match to d1ivga_
    complexed with ca, gol, nag, slb

Details for d4h53c_

PDB Entry: 4h53 (more details), 1.5 Å

PDB Description: influenza n2-tyr406asp neuraminidase in complex with beta-neu5ac
PDB Compounds: (C:) Neuraminidase

SCOPe Domain Sequences for d4h53c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h53c_ b.68.1.1 (C:) automated matches {Influenza A virus [TaxId: 382827]}
veyrnwskpqcqitgfapfskdnsirlsaggdiwvtrepyvscdpgkcyqfalgqgttld
nkhsndtvhdriphrtllmnelgvpfhlgtrqvciawsssschdgkawlhvcitgddkna
tasfiydgrlvdsigswsqnilrtqesecvcingtctvvmtdgsasgradtrilfieegk
ivhisplsgsaqhieecscyprypgvrcicrdnwkgsnrpvvdinmedysidssyvcsgl
vgdtprnddsssnsncrnpnnergtqgvkgwafdngndlwmgrtiskesrsgyetfkvig
gwstpnsksqvnrqvivdnnnwsgdsgifsvegkscinrcfyvelirgrpqetrvwwtsn
sivvfcgtsgtygtgswpdganinfmpi

SCOPe Domain Coordinates for d4h53c_:

Click to download the PDB-style file with coordinates for d4h53c_.
(The format of our PDB-style files is described here.)

Timeline for d4h53c_: