PDB entry 4h53

View 4h53 on RCSB PDB site
Description: Influenza N2-Tyr406Asp neuraminidase in complex with beta-Neu5Ac
Class: hydrolase
Keywords: neuraminidase, influenza virus surface, hydrolase
Deposited on 2012-09-18, released 2013-02-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-07-31, with a file datestamp of 2013-07-26.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.141
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:382827]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q194T1 (0-387)
      • engineered mutation (324)
    Domains in SCOPe 2.07: d4h53a_
  • Chain 'B':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:382827]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q194T1 (0-387)
      • engineered mutation (324)
    Domains in SCOPe 2.07: d4h53b_
  • Chain 'C':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:382827]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q194T1 (0-387)
      • engineered mutation (324)
    Domains in SCOPe 2.07: d4h53c_
  • Chain 'D':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:382827]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q194T1 (0-387)
      • engineered mutation (324)
    Domains in SCOPe 2.07: d4h53d_
  • Heterogens: CA, NAG, SLB, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4h53A (A:)
    veyrnwskpqcqitgfapfskdnsirlsaggdiwvtrepyvscdpgkcyqfalgqgttld
    nkhsndtvhdriphrtllmnelgvpfhlgtrqvciawsssschdgkawlhvcitgddkna
    tasfiydgrlvdsigswsqnilrtqesecvcingtctvvmtdgsasgradtrilfieegk
    ivhisplsgsaqhieecscyprypgvrcicrdnwkgsnrpvvdinmedysidssyvcsgl
    vgdtprnddsssnsncrnpnnergtqgvkgwafdngndlwmgrtiskesrsgyetfkvig
    gwstpnsksqvnrqvivdnnnwsgdsgifsvegkscinrcfyvelirgrpqetrvwwtsn
    sivvfcgtsgtygtgswpdganinfmpi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4h53B (B:)
    veyrnwskpqcqitgfapfskdnsirlsaggdiwvtrepyvscdpgkcyqfalgqgttld
    nkhsndtvhdriphrtllmnelgvpfhlgtrqvciawsssschdgkawlhvcitgddkna
    tasfiydgrlvdsigswsqnilrtqesecvcingtctvvmtdgsasgradtrilfieegk
    ivhisplsgsaqhieecscyprypgvrcicrdnwkgsnrpvvdinmedysidssyvcsgl
    vgdtprnddsssnsncrnpnnergtqgvkgwafdngndlwmgrtiskesrsgyetfkvig
    gwstpnsksqvnrqvivdnnnwsgdsgifsvegkscinrcfyvelirgrpqetrvwwtsn
    sivvfcgtsgtygtgswpdganinfmpi
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4h53C (C:)
    veyrnwskpqcqitgfapfskdnsirlsaggdiwvtrepyvscdpgkcyqfalgqgttld
    nkhsndtvhdriphrtllmnelgvpfhlgtrqvciawsssschdgkawlhvcitgddkna
    tasfiydgrlvdsigswsqnilrtqesecvcingtctvvmtdgsasgradtrilfieegk
    ivhisplsgsaqhieecscyprypgvrcicrdnwkgsnrpvvdinmedysidssyvcsgl
    vgdtprnddsssnsncrnpnnergtqgvkgwafdngndlwmgrtiskesrsgyetfkvig
    gwstpnsksqvnrqvivdnnnwsgdsgifsvegkscinrcfyvelirgrpqetrvwwtsn
    sivvfcgtsgtygtgswpdganinfmpi
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4h53D (D:)
    veyrnwskpqcqitgfapfskdnsirlsaggdiwvtrepyvscdpgkcyqfalgqgttld
    nkhsndtvhdriphrtllmnelgvpfhlgtrqvciawsssschdgkawlhvcitgddkna
    tasfiydgrlvdsigswsqnilrtqesecvcingtctvvmtdgsasgradtrilfieegk
    ivhisplsgsaqhieecscyprypgvrcicrdnwkgsnrpvvdinmedysidssyvcsgl
    vgdtprnddsssnsncrnpnnergtqgvkgwafdngndlwmgrtiskesrsgyetfkvig
    gwstpnsksqvnrqvivdnnnwsgdsgifsvegkscinrcfyvelirgrpqetrvwwtsn
    sivvfcgtsgtygtgswpdganinfmpi