Lineage for d4jsqg_ (4jsq G:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1222614Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1222615Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1222781Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1223777Protein automated matches [190144] (8 species)
    not a true protein
  7. 1224163Species Saccharomyces cerevisiae [TaxId:559292] [189752] (11 PDB entries)
  8. 1224178Domain d4jsqg_: 4jsq G: [192967]
    Other proteins in same PDB: d4jsqk_, d4jsqy_
    automated match to d1rypa_
    complexed with mes

Details for d4jsqg_

PDB Entry: 4jsq (more details), 2.8 Å

PDB Description: Yeast 20S proteasome in complex with the dimerized linear mimetic of TMC-95A - yCP:4e
PDB Compounds: (G:) Proteasome subunit alpha type-1

SCOPe Domain Sequences for d4jsqg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jsqg_ d.153.1.4 (G:) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv
syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt
qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks
kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia
eqd

SCOPe Domain Coordinates for d4jsqg_:

Click to download the PDB-style file with coordinates for d4jsqg_.
(The format of our PDB-style files is described here.)

Timeline for d4jsqg_: