PDB entry 4jsq
View 4jsq on RCSB PDB site
Description: Yeast 20S proteasome in complex with the dimerized linear mimetic of TMC-95A - yCP:4e
Class: hydrolase/hydrolase inhibitor
Keywords: UPS, proteasome, drug discovery, non-covalent reversible inhibition, bivalence, TMC-95A derivatives, Ntn hydrolase, non-lysosomal protein breakdown, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on
2013-03-22, released
2013-05-01
The last revision prior to the SCOPe 2.02 freeze date was dated
2013-05-01, with a file datestamp of
2013-04-26.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.236
AEROSPACI score: 0.26
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Proteasome subunit alpha type-2
Species: Saccharomyces cerevisiae [TaxId:559292]
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: Proteasome subunit alpha type-3
Species: Saccharomyces cerevisiae [TaxId:559292]
Database cross-references and differences (RAF-indexed):
- Chain 'C':
Compound: Proteasome subunit alpha type-4
Species: Saccharomyces cerevisiae [TaxId:559292]
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: Proteasome subunit alpha type-5
Species: Saccharomyces cerevisiae [TaxId:559292]
Database cross-references and differences (RAF-indexed):
- Chain 'E':
Compound: Proteasome subunit alpha type-6
Species: Saccharomyces cerevisiae [TaxId:559292]
Database cross-references and differences (RAF-indexed):
- Chain 'F':
Compound: probable proteasome subunit alpha type-7
Species: Saccharomyces cerevisiae [TaxId:559292]
Database cross-references and differences (RAF-indexed):
- Chain 'G':
Compound: Proteasome subunit alpha type-1
Species: Saccharomyces cerevisiae [TaxId:559292]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d4jsqg_ - Chain 'H':
Compound: Proteasome subunit beta type-2
Species: Saccharomyces cerevisiae [TaxId:559292]
Database cross-references and differences (RAF-indexed):
- Chain 'I':
Compound: Proteasome subunit beta type-3
Species: Saccharomyces cerevisiae [TaxId:559292]
Database cross-references and differences (RAF-indexed):
- Chain 'J':
Compound: Proteasome subunit beta type-4
Species: Saccharomyces cerevisiae [TaxId:559292]
Database cross-references and differences (RAF-indexed):
- Chain 'K':
Compound: Proteasome subunit beta type-5
Species: Saccharomyces cerevisiae [TaxId:559292]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d4jsqk_ - Chain 'L':
Compound: Proteasome subunit beta type-6
Species: Saccharomyces cerevisiae [TaxId:559292]
Database cross-references and differences (RAF-indexed):
- Chain 'M':
Compound: Proteasome subunit beta type-7
Species: Saccharomyces cerevisiae [TaxId:559292]
Database cross-references and differences (RAF-indexed):
- Chain 'N':
Compound: Proteasome subunit beta type-1
Species: Saccharomyces cerevisiae [TaxId:559292]
Database cross-references and differences (RAF-indexed):
- Chain 'O':
Compound: Proteasome subunit alpha type-2
Species: Saccharomyces cerevisiae [TaxId:559292]
Database cross-references and differences (RAF-indexed):
- Chain 'P':
Compound: Proteasome subunit alpha type-3
Species: Saccharomyces cerevisiae [TaxId:559292]
Database cross-references and differences (RAF-indexed):
- Chain 'Q':
Compound: Proteasome subunit alpha type-4
Species: Saccharomyces cerevisiae [TaxId:559292]
Database cross-references and differences (RAF-indexed):
- Chain 'R':
Compound: Proteasome subunit alpha type-5
Species: Saccharomyces cerevisiae [TaxId:559292]
Database cross-references and differences (RAF-indexed):
- Chain 'S':
Compound: Proteasome subunit alpha type-6
Species: Saccharomyces cerevisiae [TaxId:559292]
Database cross-references and differences (RAF-indexed):
- Chain 'T':
Compound: probable proteasome subunit alpha type-7
Species: Saccharomyces cerevisiae [TaxId:559292]
Database cross-references and differences (RAF-indexed):
- Chain 'U':
Compound: Proteasome subunit alpha type-1
Species: Saccharomyces cerevisiae [TaxId:559292]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d4jsqu_ - Chain 'V':
Compound: Proteasome subunit beta type-2
Species: Saccharomyces cerevisiae [TaxId:559292]
Database cross-references and differences (RAF-indexed):
- Chain 'W':
Compound: Proteasome subunit beta type-3
Species: Saccharomyces cerevisiae [TaxId:559292]
Database cross-references and differences (RAF-indexed):
- Chain 'X':
Compound: Proteasome subunit beta type-4
Species: Saccharomyces cerevisiae [TaxId:559292]
Database cross-references and differences (RAF-indexed):
- Chain 'Y':
Compound: Proteasome subunit beta type-5
Species: Saccharomyces cerevisiae [TaxId:559292]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d4jsqy_ - Chain 'Z':
Compound: Proteasome subunit beta type-6
Species: Saccharomyces cerevisiae [TaxId:559292]
Database cross-references and differences (RAF-indexed):
- Chain 'a':
Compound: Proteasome subunit beta type-7
Species: Saccharomyces cerevisiae [TaxId:559292]
Database cross-references and differences (RAF-indexed):
- Chain 'b':
Compound: Proteasome subunit beta type-1
Species: Saccharomyces cerevisiae [TaxId:559292]
Database cross-references and differences (RAF-indexed):
- Chain 'c':
Compound: TMC-95A mimic ligand yCP:4e
Database cross-references and differences (RAF-indexed):
- Chain 'd':
Compound: TMC-95A mimic ligand yCP:4e
Database cross-references and differences (RAF-indexed):
- Heterogens: MES, HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
No sequence available.
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.
- Chain 'E':
No sequence available.
- Chain 'F':
No sequence available.
- Chain 'G':
Sequence, based on SEQRES records: (download)
>4jsqG (G:)
msgaaaasaagydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvp
dklldpttvsyifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakr
manlsqiytqraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeitt
nlenhfkkskidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaen
ieerlvaiaeqd
Sequence, based on observed residues (ATOM records): (download)
>4jsqG (G:)
agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv
syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt
qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks
kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia
eqd
- Chain 'H':
No sequence available.
- Chain 'I':
No sequence available.
- Chain 'J':
No sequence available.
- Chain 'K':
Sequence; same for both SEQRES and ATOM records: (download)
>4jsqK (K:)
tttlafrfqggiivavdsratagnwvasqtvkkvieinpfllgtmaggaadcqfwetwlg
sqcrlhelrekerisvaaaskilsnlvyqykgaglsmgtmicgytrkegptiyyvdsdgt
rlkgdifcvgsgqtfaygvldsnykwdlsvedalylgkrsilaaahrdaysggsvnlyhv
tedgwiyhgnhdvgelfwkvkeeegsfnnvig
- Chain 'L':
No sequence available.
- Chain 'M':
No sequence available.
- Chain 'N':
No sequence available.
- Chain 'O':
No sequence available.
- Chain 'P':
No sequence available.
- Chain 'Q':
No sequence available.
- Chain 'R':
No sequence available.
- Chain 'S':
No sequence available.
- Chain 'T':
No sequence available.
- Chain 'U':
Sequence, based on SEQRES records: (download)
>4jsqU (U:)
msgaaaasaagydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvp
dklldpttvsyifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakr
manlsqiytqraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeitt
nlenhfkkskidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaen
ieerlvaiaeqd
Sequence, based on observed residues (ATOM records): (download)
>4jsqU (U:)
agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv
syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt
qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks
kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia
eqd
- Chain 'V':
No sequence available.
- Chain 'W':
No sequence available.
- Chain 'X':
No sequence available.
- Chain 'Y':
Sequence; same for both SEQRES and ATOM records: (download)
>4jsqY (Y:)
tttlafrfqggiivavdsratagnwvasqtvkkvieinpfllgtmaggaadcqfwetwlg
sqcrlhelrekerisvaaaskilsnlvyqykgaglsmgtmicgytrkegptiyyvdsdgt
rlkgdifcvgsgqtfaygvldsnykwdlsvedalylgkrsilaaahrdaysggsvnlyhv
tedgwiyhgnhdvgelfwkvkeeegsfnnvig
- Chain 'Z':
No sequence available.
- Chain 'a':
No sequence available.
- Chain 'b':
No sequence available.
- Chain 'c':
No sequence available.
- Chain 'd':
No sequence available.