Lineage for d4fa5c_ (4fa5 C:)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1243277Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
    disulfide-rich; nearly all-beta
  4. 1243278Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) (S)
  5. 1243279Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins)
  6. 1243300Protein automated matches [190303] (2 species)
    not a true protein
  7. 1243301Species Paracoccus denitrificans [TaxId:266] [187112] (12 PDB entries)
  8. 1243302Domain d4fa5c_: 4fa5 C: [192653]
    automated match to d2bbkl_
    complexed with ca, edo, hec, mes, na

Details for d4fa5c_

PDB Entry: 4fa5 (more details), 1.94 Å

PDB Description: Crystal Structure of WT MauG in Complex with Pre-Methylamine Dehydrogenase Aged 20 Days
PDB Compounds: (C:) Methylamine dehydrogenase light chain

SCOPe Domain Sequences for d4fa5c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fa5c_ g.21.1.1 (C:) automated matches {Paracoccus denitrificans [TaxId: 266]}
tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgkashhhh

SCOPe Domain Coordinates for d4fa5c_:

Click to download the PDB-style file with coordinates for d4fa5c_.
(The format of our PDB-style files is described here.)

Timeline for d4fa5c_: