PDB entry 4fa5

View 4fa5 on RCSB PDB site
Description: Crystal Structure of WT MauG in Complex with Pre-Methylamine Dehydrogenase Aged 20 Days
Class: Oxidoreductase/Electron transport
Keywords: tryptophan tryptophylquinone, Oxidoreductase-Electron Transfer complex, Oxidoreductase-Electron transport complex
Deposited on 2012-05-21, released 2013-03-06
The last revision prior to the SCOPe 2.02 freeze date was dated 2013-03-06, with a file datestamp of 2013-03-01.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.154
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methylamine utilization protein MauG
    Species: Paracoccus denitrificans [TaxId:318586]
    Gene: mauG, Pden_4736
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Methylamine utilization protein MauG
    Species: Paracoccus denitrificans [TaxId:318586]
    Gene: mauG, Pden_4736
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Methylamine dehydrogenase light chain
    Species: Paracoccus denitrificans [TaxId:266]
    Gene: mauA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22619 (Start-130)
      • expression tag (131-134)
    Domains in SCOPe 2.02: d4fa5c_
  • Chain 'D':
    Compound: Methylamine dehydrogenase heavy chain
    Species: Paracoccus denitrificans [TaxId:318586]
    Gene: Pden_4730
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Methylamine dehydrogenase light chain
    Species: Paracoccus denitrificans [TaxId:266]
    Gene: mauA
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Methylamine dehydrogenase heavy chain
    Species: Paracoccus denitrificans [TaxId:318586]
    Gene: Pden_4730
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, HEC, EDO, NA, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4fa5C (C:)
    adapagtdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvas
    cynptdgqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyh
    ctispivgkashhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fa5C (C:)
    tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
    gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
    vgkashhhh
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.