Lineage for d4fa5c1 (4fa5 C:7-131)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3034451Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
    disulfide-rich; nearly all-beta
  4. 3034452Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) (S)
  5. 3034453Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins)
    automatically mapped to Pfam PF02975
  6. 3034454Protein Methylamine dehydrogenase [57563] (2 species)
  7. 3034455Species Paracoccus denitrificans [TaxId:266] [57564] (24 PDB entries)
  8. 3034468Domain d4fa5c1: 4fa5 C:7-131 [192653]
    Other proteins in same PDB: d4fa5c2
    automated match to d2bbkl_
    complexed with ca, edo, hec, mes, na

Details for d4fa5c1

PDB Entry: 4fa5 (more details), 1.94 Å

PDB Description: Crystal Structure of WT MauG in Complex with Pre-Methylamine Dehydrogenase Aged 20 Days
PDB Compounds: (C:) Methylamine dehydrogenase light chain

SCOPe Domain Sequences for d4fa5c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fa5c1 g.21.1.1 (C:7-131) Methylamine dehydrogenase {Paracoccus denitrificans [TaxId: 266]}
tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgkas

SCOPe Domain Coordinates for d4fa5c1:

Click to download the PDB-style file with coordinates for d4fa5c1.
(The format of our PDB-style files is described here.)

Timeline for d4fa5c1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4fa5c2
View in 3D
Domains from other chains:
(mouse over for more information)
d4fa5e_