SCOPe 2.08: Domain d3vfab_: 3vfa B:

Lineage for d3vfab_ (3vfa B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (9 species)

7. Species Human immunodeficiency virus type 1 lw12.3 isolate [TaxId:82834] [189723] (3 PDB entries)

8. Domain d3vfab_: 3vfa B: [192562]
   automated match to d2aoga_
   complexed with 031, cl, na; mutant

Details for d3vfab_

PDB Entry: 3vfa, 1.43 Å

PDB Description: crystal structure of hiv-1 protease mutant v82a with novel p1'-ligands grl-02031

PDB Compounds: (B:) Protease

SCOPe Domain Sequences for d3vfab_:

Sequence; same for both SEQRES and ATOM records:

>d3vfab_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 lw12.3 isolate [TaxId: 82834]}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpaniigrnlltqigatlnf

Timeline for d3vfab_:

• d3vfab_ first appeared in SCOPe 2.02
  
• d3vfab_ appears in SCOPe 2.07