PDB entry 3vfa

View 3vfa on RCSB PDB site
Description: Crystal Structure of HIV-1 Protease Mutant V82A with novel P1'-Ligands GRL-02031
Class: hydrolase/hydrolase inhibitor
Keywords: protease inhibitor,P1'-ligand, hydrolase-hydrolase inhibitor complex
Deposited on 2012-01-09, released 2012-11-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-03-25, with a file datestamp of 2015-03-20.
Experiment type: XRAY
Resolution: 1.43 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protease
  Species: Human immunodeficiency virus type 1 lw12.3 isolate [TaxId:82834]
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0C6F2 (0-98)
    • engineered mutation (6)
    • engineered mutation (32)
    • engineered mutation (62)
    • engineered mutation (66)
    • engineered mutation (81)
    • engineered mutation (94)
  Domains in SCOPe 2.08: d3vfaa_
• Chain 'B':
  Compound: Protease
  Species: Human immunodeficiency virus type 1 lw12.3 isolate [TaxId:82834]
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0C6F2 (0-98)
    • engineered mutation (6)
    • engineered mutation (32)
    • engineered mutation (62)
    • engineered mutation (66)
    • engineered mutation (81)
    • engineered mutation (94)
  Domains in SCOPe 2.08: d3vfab_
• Heterogens: 031, NA, CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3vfaA (A:)
  pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
  qiiieiaghkaigtvlvgptpaniigrnlltqigatlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3vfaB (B:)
  pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
  qiiieiaghkaigtvlvgptpaniigrnlltqigatlnf