Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (3 species) |
Species Cow (Bos taurus) [TaxId:9913] [50523] (66 PDB entries) Uniprot P00766 |
Domain d3t62c_: 3t62 C: [192125] Other proteins in same PDB: d3t62d_, d3t62e_, d3t62f_ automated match to d1k2i1_ complexed with so4 |
PDB Entry: 3t62 (more details), 2 Å
SCOPe Domain Sequences for d3t62c_:
Sequence, based on SEQRES records: (download)
>d3t62c_ b.47.1.2 (C:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} cgvpaiqpvlsglsrivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa vclpsasddfaagttcvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdam icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq tlaan
>d3t62c_ b.47.1.2 (C:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} cgvpaiqpvlsgivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvtts dvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavcl psasddfaagttcvttgwgltryantpdrlqqaslpllsntnckkywgtkikdamicaga sgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan
Timeline for d3t62c_: