Lineage for d3sxea_ (3sxe A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1868080Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 1868081Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 1868464Family c.68.1.9: alpha-1,3-galactosyltransferase-like [64131] (4 proteins)
    automatically mapped to Pfam PF03414
  6. 1868505Protein Glycosyltransferase A catalytic domain [75276] (1 species)
    involved in blood group antigen biosynthesis
  7. 1868506Species Human (Homo sapiens) [TaxId:9606] [75277] (52 PDB entries)
    Uniprot P16442 64-345
  8. 1868517Domain d3sxea_: 3sxe A: [192090]
    automated match to d1lzia_
    complexed with gal, mn, udp

Details for d3sxea_

PDB Entry: 3sxe (more details), 1.49 Å

PDB Description: crystal structure of aaaa+udp+gal with glycerol as the cryoprotectant
PDB Compounds: (A:) Histo-blood group ABO system transferase

SCOPe Domain Sequences for d3sxea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sxea_ c.68.1.9 (A:) Glycosyltransferase A catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
fmvslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvf
aikkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevraykrw
qdvsmrrmemisdfcerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpgfygssr
eaftyerrpqsqayipkdegdfyylggffggsvqevqrltrachqammvdqangieavwh
deshlnkyllrhkptkvlspeylwdqqllgwpavlrklrftavpknhqavrnp

SCOPe Domain Coordinates for d3sxea_:

Click to download the PDB-style file with coordinates for d3sxea_.
(The format of our PDB-style files is described here.)

Timeline for d3sxea_: