PDB entry 3sxe

View 3sxe on RCSB PDB site
Description: Crystal structure of AAAA+UDP+Gal with Glycerol as the cryoprotectant
Class: transferase
Keywords: retaining glycosyltransferase, glycoprotein, blood group antigen, ABO Rossmann fold, metal-binding, manganese, TRANSFERASE
Deposited on 2011-07-14, released 2012-02-29
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-03-28, with a file datestamp of 2012-03-23.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: 0.192
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histo-blood group ABO system transferase
    Species: Homo sapiens [TaxId:9606]
    Gene: ABO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16442 (2-292)
      • expression tag (0-1)
    Domains in SCOPe 2.05: d3sxea_
  • Heterogens: UDP, GAL, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3sxeA (A:)
fmvslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvf
aikkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevraykrw
qdvsmrrmemisdfcerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpgfygssr
eaftyerrpqsqayipkdegdfyylggffggsvqevqrltrachqammvdqangieavwh
deshlnkyllrhkptkvlspeylwdqqllgwpavlrklrftavpknhqavrnp