Lineage for d3sxea1 (3sxe A:64-354)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2149496Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2149497Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2149926Family c.68.1.9: alpha-1,3-galactosyltransferase-like [64131] (4 proteins)
    automatically mapped to Pfam PF03414
  6. 2149979Protein Glycosyltransferase A catalytic domain [75276] (1 species)
    involved in blood group antigen biosynthesis
  7. 2149980Species Human (Homo sapiens) [TaxId:9606] [75277] (53 PDB entries)
    Uniprot P16442 64-345
  8. 2149991Domain d3sxea1: 3sxe A:64-354 [192090]
    Other proteins in same PDB: d3sxea2
    automated match to d1lzia_
    complexed with gal, mn, udp

Details for d3sxea1

PDB Entry: 3sxe (more details), 1.49 Å

PDB Description: crystal structure of aaaa+udp+gal with glycerol as the cryoprotectant
PDB Compounds: (A:) Histo-blood group ABO system transferase

SCOPe Domain Sequences for d3sxea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sxea1 c.68.1.9 (A:64-354) Glycosyltransferase A catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
vslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfai
kkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevraykrwqd
vsmrrmemisdfcerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpgfygssrea
ftyerrpqsqayipkdegdfyylggffggsvqevqrltrachqammvdqangieavwhde
shlnkyllrhkptkvlspeylwdqqllgwpavlrklrftavpknhqavrnp

SCOPe Domain Coordinates for d3sxea1:

Click to download the PDB-style file with coordinates for d3sxea1.
(The format of our PDB-style files is described here.)

Timeline for d3sxea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3sxea2