![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
![]() | Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) ![]() |
![]() | Family c.68.1.9: alpha-1,3-galactosyltransferase-like [64131] (4 proteins) automatically mapped to Pfam PF03414 |
![]() | Protein Glycosyltransferase A catalytic domain [75276] (1 species) involved in blood group antigen biosynthesis |
![]() | Species Human (Homo sapiens) [TaxId:9606] [75277] (53 PDB entries) Uniprot P16442 64-345 |
![]() | Domain d3sxea1: 3sxe A:64-354 [192090] Other proteins in same PDB: d3sxea2 automated match to d1lzia_ complexed with gal, mn, udp |
PDB Entry: 3sxe (more details), 1.49 Å
SCOPe Domain Sequences for d3sxea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sxea1 c.68.1.9 (A:64-354) Glycosyltransferase A catalytic domain {Human (Homo sapiens) [TaxId: 9606]} vslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfai kkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevraykrwqd vsmrrmemisdfcerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpgfygssrea ftyerrpqsqayipkdegdfyylggffggsvqevqrltrachqammvdqangieavwhde shlnkyllrhkptkvlspeylwdqqllgwpavlrklrftavpknhqavrnp
Timeline for d3sxea1: