Lineage for d3oeur_ (3oeu R:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1437613Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1437614Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1437785Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1439158Protein automated matches [190144] (7 species)
    not a true protein
  7. 1439383Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (16 PDB entries)
  8. 1439389Domain d3oeur_: 3oeu R: [191909]
    Other proteins in same PDB: d3oeu1_, d3oeu2_, d3oeua_, d3oeuc_, d3oeue_, d3oeuf_, d3oeug_, d3oeuh_, d3oeui_, d3oeuj_, d3oeuk_, d3oeul_, d3oeum_, d3oeun_, d3oeuo_, d3oeuq_, d3oeus_, d3oeuu_, d3oeuv_, d3oeuw_, d3oeux_, d3oeuy_, d3oeuz_
    automated match to d1jd2y_
    complexed with mes, mg, oeu

Details for d3oeur_

PDB Entry: 3oeu (more details), 2.6 Å

PDB Description: Structure of yeast 20S open-gate proteasome with Compound 24
PDB Compounds: (R:) Proteasome component PUP2

SCOPe Domain Sequences for d3oeur_:

Sequence, based on SEQRES records: (download)

>d3oeur_ d.153.1.4 (R:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
ae

Sequence, based on observed residues (ATOM records): (download)

>d3oeur_ d.153.1.4 (R:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgerlm
srpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewhssltlk
eaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekeaae

SCOPe Domain Coordinates for d3oeur_:

Click to download the PDB-style file with coordinates for d3oeur_.
(The format of our PDB-style files is described here.)

Timeline for d3oeur_: