Lineage for d3oeuo_ (3oeu O:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1437613Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1437614Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1437785Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1438333Protein Proteasome beta subunit (catalytic) [56252] (5 species)
  7. 1438342Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (50 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 1438442Domain d3oeuo_: 3oeu O: [200057]
    Other proteins in same PDB: d3oeub_, d3oeud_, d3oeuf_, d3oeur_
    automated match to d1jd2v_
    complexed with mes, mg, oeu

Details for d3oeuo_

PDB Entry: 3oeu (more details), 2.6 Å

PDB Description: Structure of yeast 20S open-gate proteasome with Compound 24
PDB Compounds: (O:) Proteasome component Y7

SCOPe Domain Sequences for d3oeuo_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oeuo_ d.153.1.4 (O:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mtdrysfslttfspsgklgqidyaltavkqgvtslgikatngvviatekksssplamset
lskvslltpdigavysgmgpdyrvlvdksrkvahtsykriygeypptkllvsevakimqe
atqsggvrpfgvslliaghdefngfslyqvdpsgsyfpwkataigkgsvaaktflekrwn
deleledaihialltlkesvegefngdtielaiigdenpdllgytgiptdkgprfrklts
qeindrleal

SCOPe Domain Coordinates for d3oeuo_:

Click to download the PDB-style file with coordinates for d3oeuo_.
(The format of our PDB-style files is described here.)

Timeline for d3oeuo_: