Lineage for d3oeud_ (3oeu D:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1437613Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1437614Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1437785Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1439158Protein automated matches [190144] (7 species)
    not a true protein
  7. 1439179Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (34 PDB entries)
  8. 1439221Domain d3oeud_: 3oeu D: [200047]
    Other proteins in same PDB: d3oeu1_, d3oeu2_, d3oeua_, d3oeuc_, d3oeue_, d3oeuf_, d3oeug_, d3oeuh_, d3oeui_, d3oeuj_, d3oeuk_, d3oeul_, d3oeum_, d3oeun_, d3oeuo_, d3oeuq_, d3oeus_, d3oeuu_, d3oeuv_, d3oeuw_, d3oeux_, d3oeuy_, d3oeuz_
    automated match to d3bdmd_
    complexed with mes, mg, oeu

Details for d3oeud_

PDB Entry: 3oeu (more details), 2.6 Å

PDB Description: Structure of yeast 20S open-gate proteasome with Compound 24
PDB Compounds: (D:) Proteasome component PUP2

SCOPe Domain Sequences for d3oeud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oeud_ d.153.1.4 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
ae

SCOPe Domain Coordinates for d3oeud_:

Click to download the PDB-style file with coordinates for d3oeud_.
(The format of our PDB-style files is described here.)

Timeline for d3oeud_: