Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (11 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries) |
Domain d3tddg_: 3tdd G: [185775] Other proteins in same PDB: d3tdd1_, d3tdd2_, d3tdda_, d3tddb_, d3tddc_, d3tddd_, d3tdde_, d3tddf_, d3tddh_, d3tddi_, d3tddj_, d3tddk_, d3tddl_, d3tddm_, d3tddn_, d3tddo_, d3tddp_, d3tddq_, d3tddr_, d3tdds_, d3tddt_, d3tddv_, d3tddw_, d3tddx_, d3tddy_, d3tddz_ automated match to d1g65g_ complexed with bfo |
PDB Entry: 3tdd (more details), 2.7 Å
SCOPe Domain Sequences for d3tddg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tddg_ d.153.1.4 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia eqd
Timeline for d3tddg_:
View in 3D Domains from other chains: (mouse over for more information) d3tdd1_, d3tdd2_, d3tdda_, d3tddb_, d3tddc_, d3tddd_, d3tdde_, d3tddf_, d3tddh_, d3tddi_, d3tddj_, d3tddk_, d3tddl_, d3tddm_, d3tddn_, d3tddo_, d3tddp_, d3tddq_, d3tddr_, d3tdds_, d3tddt_, d3tddu_, d3tddv_, d3tddw_, d3tddx_, d3tddy_, d3tddz_ |