Lineage for d3tddg_ (3tdd G:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1044569Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1044570Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1044729Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1045650Protein automated matches [190144] (6 species)
    not a true protein
  7. 1045999Species Saccharomyces cerevisiae [TaxId:559292] [189752] (2 PDB entries)
  8. 1046000Domain d3tddg_: 3tdd G: [185775]
    Other proteins in same PDB: d3tdd1_, d3tdd2_, d3tdda_, d3tddb_, d3tddc_, d3tdde_, d3tddf_, d3tddh_, d3tddi_, d3tddj_, d3tddk_, d3tddl_, d3tddm_, d3tddn_, d3tddo_, d3tddp_, d3tddq_, d3tdds_, d3tddt_, d3tddv_, d3tddw_, d3tddx_, d3tddy_, d3tddz_
    automated match to d1g65g_
    complexed with bfo

Details for d3tddg_

PDB Entry: 3tdd (more details), 2.7 Å

PDB Description: Crystal structure of yeast CP in complex with Belactosin C
PDB Compounds: (G:) Proteasome component C7-alpha

SCOPe Domain Sequences for d3tddg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tddg_ d.153.1.4 (G:) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv
syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt
qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks
kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia
eqd

SCOPe Domain Coordinates for d3tddg_:

Click to download the PDB-style file with coordinates for d3tddg_.
(The format of our PDB-style files is described here.)

Timeline for d3tddg_: