Lineage for d3tddb_ (3tdd B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2224887Protein Proteasome alpha subunit (non-catalytic) [56255] (8 species)
    contains an extension to the common fold at the N-terminus
  7. 2224903Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (193 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2225023Domain d3tddb_: 3tdd B: [185771]
    Other proteins in same PDB: d3tdd1_, d3tdd2_, d3tddd_, d3tddg_, d3tddh_, d3tddi_, d3tddj_, d3tddk_, d3tddl_, d3tddm_, d3tddn_, d3tddr_, d3tddu_, d3tddv_, d3tddw_, d3tddx_, d3tddy_, d3tddz_
    automated match to d1g65b_
    complexed with bfo

Details for d3tddb_

PDB Entry: 3tdd (more details), 2.7 Å

PDB Description: Crystal structure of yeast CP in complex with Belactosin C
PDB Compounds: (B:) Proteasome component Y13

SCOPe Domain Sequences for d3tddb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tddb_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
tgit

SCOPe Domain Coordinates for d3tddb_:

Click to download the PDB-style file with coordinates for d3tddb_.
(The format of our PDB-style files is described here.)

Timeline for d3tddb_: