SCOPe 2.06: Domain d3sqfb_: 3sqf B:

Lineage for d3sqfb_ (3sqf B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein automated matches [190433] (11 species)
   not a true protein

7. Species Mason-pfizer monkey virus [TaxId:11855] [189736] (1 PDB entry)

8. Domain d3sqfb_: 3sqf B: [185490]
   automated match to d1nsoa_

Details for d3sqfb_

PDB Entry: 3sqf, 1.63 Å

PDB Description: Crystal structure of monomeric M-PMV retroviral protease

PDB Compounds: (B:) Protease

SCOPe Domain Sequences for d3sqfb_:

Sequence; same for both SEQRES and ATOM records:

>d3sqfb_ b.50.1.1 (B:) automated matches {Mason-pfizer monkey virus [TaxId: 11855]}
kpsltlwlddkmftglintgadvtiikledwppnwpitdtltnlrgigqsnnpkqsskyl
twrdkennsglikpfvipnlpvnlwgrdllsqmk

Timeline for d3sqfb_:

• d3sqfb_ first appeared in SCOPe 2.01
  
• d3sqfb_ appears in SCOPe 2.05
  
• d3sqfb_ appears in SCOPe 2.07
  
• d3sqfb_ appears in the current release, SCOPe 2.08