Class b: All beta proteins [48724] (177 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (4 families) |
Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
Protein automated matches [190433] (11 species) not a true protein |
Species Mason-pfizer monkey virus [TaxId:11855] [189736] (1 PDB entry) |
Domain d3sqfa_: 3sqf A: [185489] automated match to d1nsoa_ |
PDB Entry: 3sqf (more details), 1.63 Å
SCOPe Domain Sequences for d3sqfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sqfa_ b.50.1.1 (A:) automated matches {Mason-pfizer monkey virus [TaxId: 11855]} kpsltlwlddkmftglintgadvtiikledwppnwpitdtltnlrgigqsnnpkqsskyl twrdkennsglikpfvipnlpvnlwgrdllsqmki
Timeline for d3sqfa_: