SCOPe 2.01: Domain d3pgxb_: 3pgx B:

Lineage for d3pgxb_ (3pgx B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (51 species)
   not a true protein

7. Species Mycobacterium avium [TaxId:1770] [189537] (2 PDB entries)

8. Domain d3pgxb_: 3pgx B: [183724]
   automated match to d1iy8a_
   complexed with nad

Details for d3pgxb_

PDB Entry: 3pgx, 1.85 Å

PDB Description: crystal structure of a putative carveol dehydrogenase from mycobacterium paratuberculosis bound to nicotinamide adenine dinucleotide

PDB Compounds: (B:) carveol dehydrogenase

SCOPe Domain Sequences for d3pgxb_:

Sequence; same for both SEQRES and ATOM records:

>d3pgxb_ c.2.1.0 (B:) automated matches {Mycobacterium avium [TaxId: 1770]}
gslqgrvafitgaargqgrshavrlaaegadiiacdicapvsasvtyapaspedldetar
lvedqgrkaltrvldvrddaalrelvadgmeqfgrldvvvanagvlswgrvweltdeqwd
tvigvnltgtwrtlratvpamieagnggsivvvsssaglkatpgnghysaskhgltaltn
tlaielgeygirvnsihpysvetpmiepeammeifarhpsfvhsfppmpvqpngfmtade
vadvvawlagdgsgtltgtqipvdkgalky

Timeline for d3pgxb_:

• d3pgxb_ is new in SCOPe 2.01-stable
  
• d3pgxb_ appears in SCOPe 2.02
  
• d3pgxb_ appears in the current release, SCOPe 2.08