Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (51 species) not a true protein |
Species Mycobacterium avium [TaxId:1770] [189537] (2 PDB entries) |
Domain d3pgxa_: 3pgx A: [183723] automated match to d1iy8a_ complexed with nad |
PDB Entry: 3pgx (more details), 1.85 Å
SCOPe Domain Sequences for d3pgxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pgxa_ c.2.1.0 (A:) automated matches {Mycobacterium avium [TaxId: 1770]} gslqgrvafitgaargqgrshavrlaaegadiiacdicapvsasvtyapaspedldetar lvedqgrkaltrvldvrddaalrelvadgmeqfgrldvvvanagvlswgrvweltdeqwd tvigvnltgtwrtlratvpamieagnggsivvvsssaglkatpgnghysaskhgltaltn tlaielgeygirvnsihpysvetpmiepeammeifarhpsfvhsfppmpvqpngfmtade vadvvawlagdgsgtltgtqipvdkgalky
Timeline for d3pgxa_: