Lineage for d3pgxa_ (3pgx A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 975118Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 975119Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 978249Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 978250Protein automated matches [190069] (51 species)
    not a true protein
  7. 978398Species Mycobacterium avium [TaxId:1770] [189537] (2 PDB entries)
  8. 978399Domain d3pgxa_: 3pgx A: [183723]
    automated match to d1iy8a_
    complexed with nad

Details for d3pgxa_

PDB Entry: 3pgx (more details), 1.85 Å

PDB Description: crystal structure of a putative carveol dehydrogenase from mycobacterium paratuberculosis bound to nicotinamide adenine dinucleotide
PDB Compounds: (A:) carveol dehydrogenase

SCOPe Domain Sequences for d3pgxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pgxa_ c.2.1.0 (A:) automated matches {Mycobacterium avium [TaxId: 1770]}
gslqgrvafitgaargqgrshavrlaaegadiiacdicapvsasvtyapaspedldetar
lvedqgrkaltrvldvrddaalrelvadgmeqfgrldvvvanagvlswgrvweltdeqwd
tvigvnltgtwrtlratvpamieagnggsivvvsssaglkatpgnghysaskhgltaltn
tlaielgeygirvnsihpysvetpmiepeammeifarhpsfvhsfppmpvqpngfmtade
vadvvawlagdgsgtltgtqipvdkgalky

SCOPe Domain Coordinates for d3pgxa_:

Click to download the PDB-style file with coordinates for d3pgxa_.
(The format of our PDB-style files is described here.)

Timeline for d3pgxa_: