![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
![]() | Superfamily a.26.1: 4-helical cytokines [47266] (3 families) ![]() there are two different topoisomers of this fold with different entanglements of the two crossover connections |
![]() | Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins) contains an additional helix in one of the crossover connections |
![]() | Protein automated matches [190141] (2 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [189956] (1 PDB entry) |
![]() | Domain d3oq3a_: 3oq3 A: [183231] automated match to d1itfa_ complexed with act, cl, edo, epe, zn |
PDB Entry: 3oq3 (more details), 2.1 Å
SCOPe Domain Sequences for d3oq3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3oq3a_ a.26.1.3 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} cdlpqthnlrnkraltllvkmrrlsplsclkdrkdfgfpqekvgaqqiqeaqaipvlsel tqqvlniftskdssaawnatlldsfcnevhqqlndlkacvmqqvgvqespltqedsllav rkyfhritvylrekkhspcawevvraevwralsssvnllarlskee
Timeline for d3oq3a_: