PDB entry 3oq3

View 3oq3 on RCSB PDB site
Description: Structural Basis of Type-I Interferon Sequestration by a Poxvirus Decoy Receptor
Class: cytokine/viral protein
Keywords: Ectromelia, Mousepox Virus, Moscow strain, Cytokine decoy Receptor, Virus/Viral protein, Type-1 Interferon, Soluble a/b-IFNR, Viral immune evasion, Immunoglobulin Domain, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, Immunoglobulin-like, IFN-alpha/beta binding protein, IFN-alpha, extracellular, secreted, CYTOKINE-VIRAL PROTEIN complex
Deposited on 2010-09-02, released 2011-05-18
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-05-18, with a file datestamp of 2011-05-13.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.204
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Interferon alpha-5
  Species: Mus musculus [TaxId:10090]
  Gene: Ifna5
  Database cross-references and differences (RAF-indexed):
  • Uniprot P07349 (0-165)
  Domains in SCOPe 2.01: d3oq3a_
• Chain 'B':
  Compound: IFN-alpha/beta binding protein C12R
  Species: Ectromelia virus [TaxId:265874]
  Gene: C12R, EVM166
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9JFS5 (1-328)
    • initiating methionine (0)
• Heterogens: ZN, CL, EDO, ACT, EPE, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3oq3A (A:)
  cdlpqthnlrnkraltllvkmrrlsplsclkdrkdfgfpqekvgaqqiqeaqaipvlsel
  tqqvlniftskdssaawnatlldsfcnevhqqlndlkacvmqqvgvqespltqedsllav
  rkyfhritvylrekkhspcawevvraevwralsssvnllarlskee
  

  
  
• Chain 'B':
  No sequence available.