Lineage for d3ojyc_ (3ojy C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2804248Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2804764Protein automated matches [190163] (13 species)
    not a true protein
  7. 2804796Species Human (Homo sapiens) [TaxId:9606] [188452] (14 PDB entries)
  8. 2804823Domain d3ojyc_: 3ojy C: [183071]
    automated match to d1iw2a_
    complexed with bma, ca

Details for d3ojyc_

PDB Entry: 3ojy (more details), 2.51 Å

PDB Description: crystal structure of human complement component c8
PDB Compounds: (C:) Complement component C8 gamma chain

SCOPe Domain Sequences for d3ojyc_:

Sequence, based on SEQRES records: (download)

>d3ojyc_ b.60.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
istiqpkanfdaqqfagtwllvavgsacrflqeqghraeattlhvapqgtamavstfrkl
dgicwqvrqlygdtgvlgrfllqardargavhvvvaetdyqsfavlyleragqlsvklya
rslpvsdsvlsgfeqrvqeahltedqifyfpkygfceaadqfhvldev

Sequence, based on observed residues (ATOM records): (download)

>d3ojyc_ b.60.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
istiqpkanfdaqqfagtwllvavgsacrflqeqghraeattlhvapqgtamavstfrkl
dgicwqvrqlygdtgvlgrfllqargavhvvvaetdyqsfavlyleragqlsvklyarsl
pvsdsvlsgfeqrvqeahltedqifyfpkygfceaadqfhvldev

SCOPe Domain Coordinates for d3ojyc_:

Click to download the PDB-style file with coordinates for d3ojyc_.
(The format of our PDB-style files is described here.)

Timeline for d3ojyc_: