Class b: All beta proteins [48724] (178 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins) barrel, closed; n=8, S=12, meander |
Protein automated matches [190163] (13 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188452] (14 PDB entries) |
Domain d3ojyc_: 3ojy C: [183071] automated match to d1iw2a_ complexed with bma, ca |
PDB Entry: 3ojy (more details), 2.51 Å
SCOPe Domain Sequences for d3ojyc_:
Sequence, based on SEQRES records: (download)
>d3ojyc_ b.60.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} istiqpkanfdaqqfagtwllvavgsacrflqeqghraeattlhvapqgtamavstfrkl dgicwqvrqlygdtgvlgrfllqardargavhvvvaetdyqsfavlyleragqlsvklya rslpvsdsvlsgfeqrvqeahltedqifyfpkygfceaadqfhvldev
>d3ojyc_ b.60.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} istiqpkanfdaqqfagtwllvavgsacrflqeqghraeattlhvapqgtamavstfrkl dgicwqvrqlygdtgvlgrfllqargavhvvvaetdyqsfavlyleragqlsvklyarsl pvsdsvlsgfeqrvqeahltedqifyfpkygfceaadqfhvldev
Timeline for d3ojyc_: