SCOPe 2.02: Domain d3mpda_: 3mpd A:

Lineage for d3mpda_ (3mpd A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.0: automated matches [191597] (1 protein)
   not a true family

6. Protein automated matches [191087] (5 species)
   not a true protein

7. Species Fungus (Encephalitozoon cuniculi) [TaxId:6035] [189331] (1 PDB entry)

8. Domain d3mpda_: 3mpd A: [181477]
   automated match to d1ndla_
   complexed with edo

Details for d3mpda_

PDB Entry: 3mpd, 2.08 Å

PDB Description: Crystal structure of nucleoside diphosphate kinase from encephalitozoon cuniculi, cubic form, apo

PDB Compounds: (A:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d3mpda_:

Sequence; same for both SEQRES and ATOM records:

>d3mpda_ d.58.6.0 (A:) automated matches {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]}
mertfimikpdaikrrlisriiqrfeekglylaaskcvipkrevlethyshlssmpffse
mvedmmsgmvlamvwvgkdavsigrkligetnpqaasvgtirgdygvstgkniihgsdcv
enaekeiklwigddvqpvsffdkewiy

Timeline for d3mpda_:

• d3mpda_ first appeared in SCOPe 2.01
  
• d3mpda_ appears in SCOPe 2.03
  
• d3mpda_ appears in the current release, SCOPe 2.08