Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) |
Family d.58.6.0: automated matches [191597] (1 protein) not a true family |
Protein automated matches [191087] (7 species) not a true protein |
Species Fungus (Encephalitozoon cuniculi) [TaxId:6035] [189331] (1 PDB entry) |
Domain d3mpda_: 3mpd A: [181477] automated match to d1ndla_ complexed with edo |
PDB Entry: 3mpd (more details), 2.08 Å
SCOPe Domain Sequences for d3mpda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mpda_ d.58.6.0 (A:) automated matches {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} mertfimikpdaikrrlisriiqrfeekglylaaskcvipkrevlethyshlssmpffse mvedmmsgmvlamvwvgkdavsigrkligetnpqaasvgtirgdygvstgkniihgsdcv enaekeiklwigddvqpvsffdkewiy
Timeline for d3mpda_: