![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) ![]() |
![]() | Family d.58.6.0: automated matches [191597] (1 protein) not a true family |
![]() | Protein automated matches [191087] (7 species) not a true protein |
![]() | Species Fungus (Encephalitozoon cuniculi) [TaxId:6035] [189331] (1 PDB entry) |
![]() | Domain d3mpdb_: 3mpd B: [181478] automated match to d1ndla_ complexed with edo |
PDB Entry: 3mpd (more details), 2.08 Å
SCOPe Domain Sequences for d3mpdb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mpdb_ d.58.6.0 (B:) automated matches {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} mertfimikpdaikrrlisriiqrfeekglylaaskcvipkrevlethyshlssmpffse mvedmmsgmvlamvwvgkdavsigrkligetnpqaasvgtirgdygvstgkniihgsdcv enaekeiklwigddvqpvsffdkewiy
Timeline for d3mpdb_: